No abstract

Poly(L-lactic acid) (PLA) is now a very attractive polymer for food packaging applications. In this study, PLA/poly(trimethylene carbonate) (PTMC)/talc composite films were prepared by solvent casting. The influence of the talc loading (0, 1, 2, and 3 wt %) on the phase morphology of the PLA/PTMC/talc composites and the improvement in the resulting properties are reported in this article. The scanning electron microscopy images of the composite films demonstrated good compatibility between the PLA and PTMC, whereas talc was not thoroughly distributed in the PLA matrix at talc contents exceeding 3 wt %. The tensile strength and elongation at break of the composite films significantly improved (p < 0.05). On the contrary, the water vapor permeability and oxygen properties of the composite films decreased by 24.7 and 39.2%, respectively, at the 2 wt % talc loading. Differential scanning calorimetry showed that the crystallinity of the PLA phase increased with the presence of talc filler in the PLA/PTMC/talc composites. V C 2013 Wiley Periodicals, Inc. J. Appl. Polym. Sci. 2014, 131, 40016.

The objective of the study was to evaluate the effect of a novel biodegradable membrane on the prevention of postoperative adhesion formation. The membrane was prepared by blending 50% PLA (polylactic acid) with 50% PTMC (polytrimethylene carbonate). The prepared blends polymer membrane was more flexible than pure PLA membrane, as measured by glass-transition temperature and tensile study. Cytotoxicity study revealed that PLA/PTMC blends membrane showed good biocompatibility. The membrane elicited slight tissue reaction based on the results of histological study. Thirty adult Japanese rabbits were used for the intestine adhesion model. The treatment group had PLA/PTMC membrane, the control group had chitosan, and the blank control group was not operated. The animals were housed for two weeks and sacrificed to investigate adhesion of intestine. Compared with the blank control group, the treatment group and the control group lowered the extent of adhesions (p < 0.01), but the treatment group was better than the control group (p < 0.05). The in-vivo studies confirmed that PLA/PTMC blends membrane could prevent postoperative adhesions.

Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin) was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana) and Tenebrio molitor (common mealbeetle). This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

No abstract

BF-30 is a single chain polypeptide of an N-segment with an α-helix from cathelicidin gene encoding, and it contains 30 amino acid residues, with a relative molecular mass and isoelectric point of 3637.54 and 11.79, respectively. Cathelicidin-BF-30 was entrapped in four-arm star-shaped poly(ethylene glycol-b-dl-lactic acid-co-glycolic acid) block copolymers (4-arm-PEG-PLGA) by a double-emulsion solvent-evaporation method. Three release phases of cathelicidin-BF-30loaded 4-arm-PEG-PLGA microspheres were observed, including an initial burst-release phase, followed by a lag phase with minimal drug release and finally a secondary zero-order release phase. The delivery system released BF-30 over more than 15 days in vitro. Furthermore, the material for preparing the microspheres has good biocompatibility and biodegradability. Additionally, based on the drug resistance of food pathogenic bacteria, the antibacterial effects of BF-30 on Shigella dysenteriae CMCC 51105 (Sh. dysenteriae CMCC 51105), Salmonella typhi (S. typhi) and Staphylococcus aureus (S. aureus) as well as the stability of the in vitro release of the BF-30-loded microspheres were studied. The α-helix secondary structure and antibacterial activity of released BF-30 were retained and compared with native peptide. These BF-30 loaded microspheres presented <10% hemolysis and no toxicity for HEK293T cells even at the highest tested concentration (150 μg/mL), indicating that they are hemocompatible and a promising delivery and protection system for BF-30 peptide.

A well-designed magnetic rodlike MOF-based nanocomposite confining highly dispersed Pt single atoms and clusters (denoted as Fe 3 O 4 -NR@ ZIF-8/Pt) is fabricated and plays dual functional roles in high-efficient nanocatalysis and magnetically actuated stirring. Results of the catalytic experiments for dye degradation, hydrogen production of NaBH 4 , and hydrogenation of olefins show that Fe 3 O 4 -NR@ZIF-8/Pt exhibits enhanced catalytic performance in the absence of external stirring, compared with those of traditional catalytic systems, which need external stirring. Of special note, this proposed structure provides a facile and effective methodology to improve the catalytic performance of MOF-based composites without traditional external stirring and offers an outlook toward extending more application fields of MOFs and other porous materials.

Cathelicidin-BF-30 (BF-30), a water-soluble peptide isolated from the snake venom of Bungarus fasciatus containing 30 amino acid residues, was incorporated in poly(D,L-lactide-co-glycolide) (PLGA) 75∶25 microspheres (MS) prepared by a water in oil in water W/O/W emulsification solvent extraction method. The aim of this work was to investigate the stability of BF-30 after encapsulation. D-trehalose was used as an excipient to stabilize the peptide. The MS obtained were mostly under 2 µm in size and the encapsulation efficiency was 88.50±1.29%. The secondary structure of the peptide released in vitro was determined to be nearly the same as the native peptide using Circular Dichroism (CD). The ability of BF-30 to inhibit the growth of Escherichia coli was also maintained. The cellular relative growth and hemolysis rates were 92.16±3.55% and 3.52±0.45% respectively.