In the present study,
we investigated lipid membrane interactions
of silica nanoparticles as carriers for the antimicrobial peptide
LL-37 ([LL-37, 37 aa]).
In doing so, smooth mesoporous nanoparticles were compared to virus-like
mesoporous nanoparticles, characterized by a “spiky”
external surface, as well as to nonporous silica nanoparticles. For
this, we employed a combination of neutron reflectometry, ellipsometry,
dynamic light scattering, and ζ-potential measurements for studies
of bacteria-mimicking bilayers formed by palmitoyloleoylphosphatidylcholine/palmitoyloleoylphosphatidylglycerol.
The results show that nanoparticle topography strongly influences
membrane binding and destabilization. We found that virus-like particles
are able to destabilize such lipid membranes, whereas the corresponding
smooth silica nanoparticles are not. This effect of particle spikes
becomes further accentuated after loading of such particles with LL-37.
Thus, peptide-loaded virus-like nanoparticles displayed more pronounced
membrane disruption than either peptide-loaded smooth nanoparticles
or free LL-37. The structural basis of this was clarified by neutron
reflectometry, demonstrating that the virus-like nanoparticles induce
trans-membrane defects and promote incorporation of LL-37 throughout
both bilayer leaflets. The relevance of such effects of particle spikes
for bacterial membrane rupture was further demonstrated by confocal
microscopy and live/dead assays on Escherichia coli bacteria. Taken together, these findings demonstrate that topography
influences the interaction of nanoparticles with bacteria-mimicking
lipid bilayers, both in the absence and presence of antimicrobial
peptides, as well as with bacteria. The results also identify virus-like
mesoporous nanoparticles as being of interest in the design of nanoparticles
as delivery systems for antimicrobial peptides.
In the present study,
UV-induced membrane destabilization by TiO2 (anatase) nanoparticles
was investigated by neutron reflectometry
(NR), small-angle X-ray scattering (SAXS), quartz crystal microbalance
with dissipation (QCM-D), dynamic light scattering (DLS), and ζ-potential
measurements for phospholipid bilayers formed by zwitterionic palmitoyloleoylphosphatidylcholine
(POPC) containing biologically relevant polyunsaturations. TiO2 nanoparticles displayed pH-dependent binding to such bilayers.
Nanoparticle binding alone, however, has virtually no destabilizing
effects on the lipid bilayers. In contrast, UV illumination in the
presence of TiO2 nanoparticles activates membrane destabilization
as a result of lipid oxidation caused by the generation of reactive
oxygen species (ROS), primarily •OH radicals. Despite
the short diffusion length characterizing these, the direct bilayer
attachment of TiO2 nanoparticles was demonstrated to not
be a sufficient criterion for an efficient UV-induced oxidation of
bilayer lipids, the latter also depending on ROS generation in bulk
solution. From SAXS and NR, minor structural changes were seen when
TiO2 was added in the absence of UV exposure, or on UV
exposure in the absence of TiO2 nanoparticles. In contrast,
UV exposure in the presence of TiO2 nanoparticles caused
large-scale structural transformations, especially at high ionic strength,
including gradual bilayer thinning, lateral phase separation, increases
in hydration, lipid removal, and potential solubilization into aggregates.
Taken together, the results demonstrate that nanoparticle–membrane
interactions ROS generation at different solution conditions act in
concert to induce lipid membrane destabilization on UV exposure and
that both of these need to be considered for understanding the performance
of UV-triggered TiO2 nanoparticles in nanomedicine.
scite is a Brooklyn-based organization that helps researchers better discover and understand research articles through Smart Citations–citations that display the context of the citation and describe whether the article provides supporting or contrasting evidence. scite is used by students and researchers from around the world and is funded in part by the National Science Foundation and the National Institute on Drug Abuse of the National Institutes of Health.