Specific targeting of the vasculature of gastric cancer by a new tumor-homing peptide CGNSNPKSC

Hui, Xiaoli; Han, Yu; Liang, Shuhui; Liu, Zhiguo; Liu, Jianwen; Hong, Liu; Zhao, Lina; He, Li; Cao, Shanshan; Chen, Bei; Yan, Kun; Jin, Bin; Chai, Na; Wang, Jing; Wu, Kaichun; Fan, Daiming

doi:10.1016/j.jconrel.2008.07.024

Cited by 63 publications

(45 citation statements)

References 49 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…39,40 Immunohistochemical staining, enzyme-linked immunosorbent assay, and immunofluorescence studies indicated that GX1 could be used as a novel vascular marker for human cancers. 41 Therefore, in our study, the GX1 peptide was conjugated to PNPs encapsulating Endostar, and the nanoparticles were characterized in vitro and in vivo. SEM images showed that the diameter of the GPENs was around 100 nm (Figure 2), which met the requirement for an enhanced permeability and retention effect at the tumor site.…”

Section: Discussionmentioning

confidence: 99%

GX1-conjugated poly(lactic acid) nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

Du¹,

Zhang²,

Jing³

et al. 2015

OTT

View full text Add to dashboard Cite

Section: Discussionmentioning

confidence: 99%

GX1-conjugated poly(lactic acid) nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

Du¹,

Zhang²,

Jing³

et al. 2015

OTT

View full text Add to dashboard Cite

“…The tactic of this method is to isolate the peptides that bind specifically to a target from a random peptide library, which displays peptides of 10 9~1 0 10 variants on the tip of the minor protein pIII of a filamentous phage named M13 16,17) . A simple method allowing the creation of peptides without immunization of animals, the phage display method has recently been utilized not only for organic materials [18][19][20][21][22] , but also for several inorganic materials 12,[23][24][25][26][27][28][29] . However, a peptide that binds to zirconia has yet to be identified.…”

Section: Introductionmentioning

confidence: 99%

Identification of peptide motif that binds to the surface of zirconia

et al. 2011

View full text Add to dashboard Cite

A zirconia-binding peptide motif was identified using a peptide phage display system. Yttria stabilized zirconia beads and discs were used as the target. Quartz crystal microbalance was used to monitor the binding of phages to zirconia. Starting from a library of phages displaying random sequences of 12-mer peptides, we repeated cycles of biopanning against zirconia beads. After four cycles of biopanning, we isolated a phage clone Ф#17. DNA sequencing of the corresponding portion of Ф#17 unexpectedly revealed that it displayed a 58-mer peptide (amino acid sequence: WMPSDVDINDPQGGGSRPNLHQPKPAAEAASKKKSENRKVPFYSHSWY-SSMSEDKRGW). We found that Ф#17 had a 300-fold, significantly higher binding affinity for zirconia discs than phages displaying no peptide. In quartz crystal microbalance assay, a rapid increase in energy dissipation was observed from Ф#17 but not from the control phages, indicating that Ф#17 binds to the surface of zirconia via its displayed peptide. We successfully identified a peptide motif that binds zirconia.

show abstract

“…23,24 Many novel angiogenic vessels and homing peptides have been isolated recently using this method. 17,25,26 Furthermore, in vivo phage display can screen cancer-binding peptides regardless of whether the receptor is known or not. Therefore, this technique can quickly screen cancer-specific peptides.…”

Section: Introductionmentioning

confidence: 99%

“…And four hours after the injection, part of the conjugates had moved to the metabolic system, which is a phenomenon often observed in drug pharmacokinetic studies. 15,25 It was interesting that the distribution of the conjugate in the brain was similar to that in the tumors, indicating that this PAMAM conjugate can penetrate the blood-brain barrier and enter the brain. 44,45 Although antibody, folic acid, and biotin are often used as targeting agents, the peptides screened here by an in vivo phage display method could target the unique receptors expressed by cancer cells, thus remarkably improved the targeting capability for chemotherapy.…”

mentioning

confidence: 99%

Novel peptide–dendrimer conjugates as drug carriers for targeting nonsmall cell lung cancer

Liu¹,

Liu²,

Chu³

et al. 2010

IJN

View full text Add to dashboard Cite

Phage display technology has been demonstrated to be a powerful tool for screening useful ligands that are capable of specifically binding to biomarkers on the surface of tumor cells. The ligands found by this technique, such as peptides, have been successfully applied in the fields of early cancer diagnostics and chemotherapy. In this study, a novel nonsmall cell lung cancer-targeting peptide (LCTP, sequence RCPLSHSLICY) was screened in vivo using a Ph.D.-C7C ™ phage display library. In order to develop a universal tumor-targeting drug carrier, the LCTP and fluorescence-labeled molecule (FITC) were conjugated to an acetylated polyamidoamine (PAMAM) dendrimer of generation 4 (G4) to form a PAMAM–Ac–FITC–LCTP conjugate. The performance of the conjugate was first tested in vitro. In vitro results of cell experiments analyzed by flow cytometry and inverted fluorescence microscopy indicated that PAMAM–Ac–FITC–LCTP was enriched more in NCI-H460 cells than in 293T cells, and cellular uptake was both time- and dose-dependent. The tissue distribution of the conjugate in athymic mice with lung cancer xenografts was also investigated to test the targeting efficiency of PAMAM–Ac–FITC–LCTP in vivo. The results showed that LCTP can effectively facilitate the targeting of PAMAM–Ac–FITC–LCTP to nonsmall cell lung cancer cells and tumors. These results suggest that the LCTP-conjugated PAMAM dendrimer might be a promising drug carrier for targeted cancer diagnosis and treatment.

show abstract

Specific targeting of the vasculature of gastric cancer by a new tumor-homing peptide CGNSNPKSC

Cited by 63 publications

References 49 publications

GX1-conjugated poly(lactic acid) nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

GX1-conjugated poly(lactic acid) nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

Identification of peptide motif that binds to the surface of zirconia

Novel peptide–dendrimer conjugates as drug carriers for targeting nonsmall cell lung cancer

Contact Info

Product

Resources

About

Specific targeting of the vasculature of gastric cancer by a new tumor-homing peptide CGNSNPKSC

Cited by 63 publications

References 49 publications

GX1-conjugated poly(lactic acid) nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

GX1-conjugated poly(lactic acid) nanoparticles encapsulating Endostar for improved in vivo anticolorectal cancer treatment

Identification of peptide motif that binds to the surface of zirconia

Novel peptide&ndash;dendrimer conjugates as drug carriers for targeting nonsmall cell lung cancer

Contact Info

Product

Resources

About

Novel peptide–dendrimer conjugates as drug carriers for targeting nonsmall cell lung cancer