Membrane interactions of antimicrobial peptide-loaded microgels

Nordström, Randi; Browning, Kathryn L.; Parra-Ortiz, Elisa; Damgaard, Liv Sofia Elinor; Häffner, Sara Malekkhaiat; Maestro, Armando; Campbell, Richard A.; Cooper, Joshaniel F. K.; Malmsten, Martin

doi:10.1016/j.jcis.2019.12.022

Cited by 17 publications

(14 citation statements)

References 52 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…NR also allows to simultaneously resolve potential lipid removal as well as peptide insertion into partly deuterated supported lipid bilayers (SLBs). [31][32][33][34][35][36][37][38] In an earlier work, we showed that NR results can be directly compared to results from detailed modelling of small angle X-ray scattering (SAXS) data on monomeric peptide lipid bilayer using SLBs or unilamellar vesicles respectively. 31 For supramolecular nanobers in particular, NR has an advantage over bulk methods since it lacks 3D orientation averaging and enables precise structural determination of complex MDP-membrane structures.…”

Section: Introductionmentioning

confidence: 99%

Lipid membrane interactions of self-assembling antimicrobial nanofibers: effect of PEGylation

et al. 2020

Self Cite

View full text Add to dashboard Cite

show abstract

Section: Introductionmentioning

confidence: 99%

Lipid membrane interactions of self-assembling antimicrobial nanofibers: effect of PEGylation

et al. 2020

Self Cite

View full text Add to dashboard Cite

show abstract

“…The fits were performed simultaneously for all contrasts, modeling the bilayers as consisting of three layers (inner and outer headgroups plus one single acyl chain region in the middle), plus a water layer between the SiO 2 layer of the silicon substrate and the inner lipid headgroup layer (Model 1 in Figure S2), adding the extra fitting requirement of obtaining the same area per molecule for both the head and the tail regions . Area per molecule (APM) values were calculated from the molecular volumes of fluid-phase POPC and POPG, obtained from literature data both for the head (331 and 257 Å 3 , respectively) and the tail regions, 924 Å 3 . − A fixed headgroup thickness of 7.5 Å was assumed for simplicity and for reduction of the number of free parameters in the model, based on previously reported values for negatively charged bilayers . Full lipid coverage was obtained in all cases, presenting 0 ± 2% hydration in the acyl tail region for all of the supported lipid bilayers, and surface coverages of 3.8 ± 0.2 mg/m 2 .…”

Section: Resultsmentioning

confidence: 99%

“…, relating to control of release rate, protection against proteolytic degradation, and suppression of binding to serum proteins, , thus prolonging the bloodstream circulation, as well as otherwise increased bioavailability . For such combined nanoparticle/AMP systems, even less is known with regard to membrane interactions, notably concerning the relative importance of nanoparticles, free peptide, and peptide-loaded nanoparticles, how this varies during peptide release, and how membrane interactions translate into antimicrobial effects and cell toxicity. , …”

mentioning

confidence: 99%

Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles

et al. 2021

Self Cite

View full text Add to dashboard Cite

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a “spiky” external surface, as well as to nonporous silica nanoparticles. For this, we employed a combination of neutron reflectometry, ellipsometry, dynamic light scattering, and ζ-potential measurements for studies of bacteria-mimicking bilayers formed by palmitoyloleoylphosphatidylcholine/palmitoyloleoylphosphatidylglycerol. The results show that nanoparticle topography strongly influences membrane binding and destabilization. We found that virus-like particles are able to destabilize such lipid membranes, whereas the corresponding smooth silica nanoparticles are not. This effect of particle spikes becomes further accentuated after loading of such particles with LL-37. Thus, peptide-loaded virus-like nanoparticles displayed more pronounced membrane disruption than either peptide-loaded smooth nanoparticles or free LL-37. The structural basis of this was clarified by neutron reflectometry, demonstrating that the virus-like nanoparticles induce trans-membrane defects and promote incorporation of LL-37 throughout both bilayer leaflets. The relevance of such effects of particle spikes for bacterial membrane rupture was further demonstrated by confocal microscopy and live/dead assays on Escherichia coli bacteria. Taken together, these findings demonstrate that topography influences the interaction of nanoparticles with bacteria-mimicking lipid bilayers, both in the absence and presence of antimicrobial peptides, as well as with bacteria. The results also identify virus-like mesoporous nanoparticles as being of interest in the design of nanoparticles as delivery systems for antimicrobial peptides.

show abstract

“…Further, in an effort to elucidate the mechanism of interaction between microgel-loaded AMPs and cellular membranes, Nordström et al included LL-37 into MAA microgels. The insertion of the peptides released from LL-37-loaded microgels was shown to occur without membrane defect formation at low concentrations, but with the loss of lipid from the bilayer in a concentration-dependent manner [153]. Similarly, LL-37 has been encapsulated into liquid crystalline nanoparticles (LCNPs), such as cubosomes, for the treatment of S. aureus skin infection.…”

Section: Polymeric Nanoparticles Nanoemulsions and Micellesmentioning

confidence: 99%

An Update on Antimicrobial Peptides (AMPs) and Their Delivery Strategies for Wound Infections

2020

View full text Add to dashboard Cite

Bacterial infections occur when wound healing fails to reach the final stage of healing, which is usually hindered by the presence of different pathogens. Different topical antimicrobial agents are used to inhibit bacterial growth due to antibiotic failure in reaching the infected site, which is accompanied very often by increased drug resistance and other side effects. In this review, we focus on antimicrobial peptides (AMPs), especially those with a high potential of efficacy against multidrug-resistant and biofilm-forming bacteria and fungi present in wound infections. Currently, different AMPs undergo preclinical and clinical phase to combat infection-related diseases. AMP dendrimers (AMPDs) have been mentioned as potent microbial agents. Various AMP delivery strategies that are used to combat infection and modulate the healing rate—such as polymers, scaffolds, films and wound dressings, and organic and inorganic nanoparticles—have been discussed as well. New technologies such as Clustered Regularly Interspaced Short Palindromic Repeat (CRISPR)-associated protein (CRISPR-Cas) are taken into consideration as potential future tools for AMP delivery in skin therapy.

show abstract

Membrane interactions of antimicrobial peptide-loaded microgels

Cited by 17 publications

References 52 publications

Lipid membrane interactions of self-assembling antimicrobial nanofibers: effect of PEGylation

Lipid membrane interactions of self-assembling antimicrobial nanofibers: effect of PEGylation

Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles

An Update on Antimicrobial Peptides (AMPs) and Their Delivery Strategies for Wound Infections

Contact Info

Product

Resources

About