Immunological and biochemical characterisation of 7ap, a short protein translated from an alternative frame of ORF7 of PRRSV

Olasz, Ferenc; Jankovics, I.; Bálint, Ádám; Magyar, Tibor; Belák, Sándór; Zádori, Zoltán

doi:10.1556/004.2016.027

Cited by 7 publications

(13 citation statements)

References 32 publications

(32 reference statements)

Supporting

Mentioning

Contrasting

Order By: Relevance

“…The experiments presented here proved that in addition to its IgG binding capability (Olasz et al, 2016b), 7ap also has the potential to interact with nucleic acids. Several highly positively charged peptides and proteins are unable to bind to nucleic acids (Bousarghin et al, 2003), yet the two investigated 7aps relatively strongly bind to dsDNA and ssRNA.…”

Section: Discussionsupporting

confidence: 55%

“…As we reported earlier (Olasz et al, 2016b), the 7aps of a type I (HU-14432/ 2011) (Hu7ap MTSGTTSPRLNAPSACNRSRRLSIKAQELRRFHPAGRSVFR LSLCCRLLIQCA) and a type II (WuH4) (Wu7ap MTSGITLPLVSGNCVCRRS RLPSIRVLELVPCQIQGG) strain were synthesised and purified to 95% purity by CASLO ApS (Lyngby, Denmark).…”

Section: Peptide Synthesismentioning

confidence: 99%

“…7ap of the HU-14432/2011 strain was cloned into the p-MeGFPN1 plasmid as described earlier (Olasz et al, 2016b). The resulted plasmid expressing the Hu7ap-GFP fusion protein under the control of the CMV promoter was transfected into 24-well plated Marc 145 cells using the Turbofect (Thermo Scientific, Waltham, Massachusetts) transfection reagent following the manufacturer's recommendation.…”

Section: Expression Of the Hu7ap Fusion Construct In Marc 145 Cellsmentioning

confidence: 99%

“…The cause of the failure of overexpression was that the Hu7ap protein proved to be highly toxic to the bacterial cells (Olasz et al, 2016b).…”

Section: Nucleic Acid Bindingmentioning

confidence: 99%

“…ORF7a overlaps with the coding region of the N gene (Olasz et al, 2016b). Depending on the virus strain, the length of the encoded protein (7ap) is between 36 and 53 amino acids (aa).…”

mentioning

confidence: 99%

See 4 more Smart Citations

Characterisation of the nucleic acid binding features of the PRRSV 7ap and its ability to induce antinuclear antibodies

Olasz

Jankovics

Bálint

et al. 2017

Acta Veterinaria Hungarica

Self Cite

View full text Add to dashboard Cite

A short alternative open reading frame named ORF7a has recently been discovered within the nucleocapsid gene of the porcine reproductive and respiratory syndrome virus (PRRSV) genome. Proteins (7ap) translated from the ORF7a of two divergent strains -a type I and a type II -are able to completely reduce the motility of nucleic acids at relatively high molar charge ratios in gel retardation assays indicating strong dsDNA-and ssRNA-binding capability. Conserved RNAand DNA-binding properties suggest that nucleic acid binding is a functional property of the divergent 7aps, and not an arbitrary consequence of their net positive charge. Sera from Hu7ap-immunised pigs and mice did not react with Hu7ap or Hu7ap-GFP; however, antinuclear antibodies were detected in the sera of the immunised animals, suggesting an ability of Hu7ap to interact with or mimic autoantigenic macromolecules.

show abstract

Section: Discussionsupporting

confidence: 55%

Section: Peptide Synthesismentioning

confidence: 99%

Section: Expression Of the Hu7ap Fusion Construct In Marc 145 Cellsmentioning

confidence: 99%

“…The cause of the failure of overexpression was that the Hu7ap protein proved to be highly toxic to the bacterial cells (Olasz et al, 2016b).…”

Section: Nucleic Acid Bindingmentioning

confidence: 99%

“…ORF7a overlaps with the coding region of the N gene (Olasz et al, 2016b). Depending on the virus strain, the length of the encoded protein (7ap) is between 36 and 53 amino acids (aa).…”

mentioning

confidence: 99%

See 3 more Smart Citations

Characterisation of the nucleic acid binding features of the PRRSV 7ap and its ability to induce antinuclear antibodies

Olasz

Jankovics

Bálint

et al. 2017

Acta Veterinaria Hungarica

Self Cite

View full text Add to dashboard Cite

show abstract

Coding-complete sequence of a vaccine-derived recombinant porcine reproductive and respiratory syndrome virus strain isolated in Hungary

et al. 2019

View full text Add to dashboard Cite

Porcine reproductive and respiratory syndrome virus 1 is a major cause of swine morbidity and mortality in various parts of the world, including Hungary. A national elimination programme to reduce the associated economic burden was initiated in Hungary in 2012. Using extensive laboratory surveillance, we identified and isolated an unusual PRRSV strain. The complete coding sequence of this isolate was determined and analyzed. The genome of this Hungarian PRRSV1 strain, HUN60077/16, is 15,081 nucleotides in length. Phylogenetic and recombination analysis showed a mosaic structure of the genome where a large fragment of ORF1b and the genomic region coding for ORF3 to ORF7 showed a very close genetic relationship to the vaccine virus Unistrain, while the ORF1a region, the 3’ end of ORF1b, and the whole ORF2 were only distantly related to this or any other PRRSV1 strain whose genome sequence is available in the GenBank database. Genomic characterization of PRRSV strains is crucial when possible vaccine-associated cases are identified. This approach not only helps to identify genetic interactions between vaccine and wild-type PRRSV1 strains but may also be needed to prevent trust in commercial vaccines from being undermined.

show abstract

New insights about the regulation of Nidovirus subgenomic mRNA synthesis

2018

View full text Add to dashboard Cite

The members of the Order Nidovirales share a similar genome organization with two overlapping nonstructural polyproteins encoded in the 5' two-thirds and the structural proteins encoded in the 3' third. They also express their 3' region proteins from a nested set of 3' co-terminal subgenomic messenger RNAs (sg mRNAs). Some but not all of the Nidovirus sg mRNAs also have a common 5' leader sequence that is acquired by a discontinuous RNA synthesis mechanism regulated by multiple 3' body transcription regulating sequences (TRSs) and the 5' leader TRS. Initial studies detected a single major body TRS for each 3' sg mRNA with a few alternative functional TRSs reported. The recent application of advanced techniques, such as next generation sequencing and ribosomal profiling, in studies of arteriviruses and coronaviruses has revealed an expanded sg mRNA transcriptome and coding capacity.

show abstract

Immunological and biochemical characterisation of 7ap, a short protein translated from an alternative frame of ORF7 of PRRSV

Cited by 7 publications

References 32 publications

Characterisation of the nucleic acid binding features of the PRRSV 7ap and its ability to induce antinuclear antibodies

Characterisation of the nucleic acid binding features of the PRRSV 7ap and its ability to induce antinuclear antibodies

Coding-complete sequence of a vaccine-derived recombinant porcine reproductive and respiratory syndrome virus strain isolated in Hungary

New insights about the regulation of Nidovirus subgenomic mRNA synthesis

Contact Info

Product

Resources

About