Immunoenhancing effect of Lactobacillus Reuteri on immunized mice intestine using Cholerae Toxin Subtype B

Abstract

This is an open access journal, and articles are distributed under the terms of the Creative Commons Attribution-Non Commercial-ShareAlike 4.0 License, which allows others to remix, tweak, and build upon the work non-commercially, as long as appropriate credit is given and the new creations are licensed under the identical terms.

Development of a candidate multi-epitope vaccine againstSphingobacterium spiritivorum

“…Cholera toxin B subunit is a potent mucosal adjuvant for the production of mucosal antibody responses and specific immunity. 50 The final amino acid sequence of the proposed B-cell derived T-cell based vaccine construct, which comprises a total of 250 amino acids and is a peptide vaccine construct of approximately 26 kDa, is provided below:…”

“…Cholera toxin B subunit is a potent mucosal adjuvant for the production of mucosal antibody responses and specific immunity. 50 The final amino acid sequence of the proposed B-cell derived T-cell based vaccine construct, which comprises a total of 250 amino acids and is a peptide vaccine construct of approximately 26 kDa, is provided below: MIKLKFGVFFTVLLSSAYAHGTPQNITDL-CAEYHNTQIYTLNDKIFSYTESLAGKREMAIIT FKNGAIFQVEVPGSQHIDSQKKAIERMKDTL- Vaccine against S. Spiritivorum ... Alamri RIAYLTEAKVEKLCVWNNKTPHAIAAISMA-NEAAAKNAGVNRNDAGPGPGELKLAKGLKGP-GPGTLNDKRSSDGPGPGETKRASTDLGPGPG-GFDPEVGMDGPGPGYTFHREDEKGPGPGYDD-AEIIKVGPGPGHADEQRMFSGPGPGKSSLEVSKA Vaccine safety, antigenicity, solubility and physiochemical properties: According to the findings of the AllerTop online server, the vaccine construct is not allergenic, and the antigenicity scores for VaxiJen and ANTIGENpro were 0.8101 and 0.9144, respectively, indicating that they can effectively elicit a strong immune response. According to ToxinPred and SoluProt prediction results, the construct is non-toxic and water soluble by nature (0.916).…”

Shigella flexneri vaccine development: Oral administration of peptides derived from the 49.8 kDa pili protein subunit activates the intestinal immune response in mice

“…We performed immunization by orally administering 50 µg of peptide in 50 µl of adjuvant once a week for 4 weeks. We sacrificed the mice 1 week after the last immunization [28]. As antigens, we used synthetic peptides from the 49.8 kDa S. flexneri pili protein named pep_1, pep_2, and pep_3 (Apical Scientific Sdn.…”

“…We quantified IL-4 and IL-17 from intestinal mesentery and sIgA and β-defensin from intestinal Available at www.veterinaryworld.org/Vol.15/February-2022/7.pdf mucosal tissue using an enzyme-linked immunoassay (Zenix-320 microplate reader) according to the manufacturer's instructions (Bioassay Technology Laboratory, Shanghai, China) [28].…”