A novel molluscan insulin-related peptide (MIP) 111, has been isolated from alcohol extracts of the neurohaemal area of the cerebral neuroendocrine light-green neurones of Lymnaea stagnalis. MIP 111 was purified by sequential high-performance gel-permeation chromatography followed by reversephase HPLC. MIP 111 is a heterodimer connected by disulphide bonds. Edman degradation analysis and subsequent alignment with the A and B chains of the previously identified MIP I and I1showed that the 24-amino-acid peptide with the sequence pQSRPSIVC(E)CCFNQCTVQ(E)LLAYC represents the MIP I11 A chain, and the 37-amino-acid peptide sequence TTQHTCSILSRPHPRG-LCGSTLANMVQWLCSTYTTSS the B chain. The overall amino acid sequence of MIP I11 shows about 50% similarity with those of MIP I and 11, and only 20-40% similarity with other peptides of the insulin superfamily. Important structural features, e. g. disulphide bridges and the hydrophobic core, are conserved in MIP 111.The cerebral neuroendocrine light-green cells (LGC) of the freshwater pulmonate snail, Lymnaeu stagnalis, form a suitable object for the study of basic characteristics of peptidergic neurones [l]. These cells are present as four clusters of altogether approximately 150 identifiable giant neurones, which use the periphery of the two median lip nerves as their neurohaemal area. Endocrinological experiments have shown that the secretions of the LGC control various different processes, such as body growth [2, 31, carbohydrate metabolism [3] and reproductive activities [4].Molecular genetic studies have demonstrated that the LGC express two genes coding for the distinct, though related, molluscan insulin-related peptides (MIP) I and I1 [5,6]. Here, we present evidence that the LGC express yet another MIP, designated MIP 111, which has only approximately N 50% similarity with MIP I and 11. These findings indicate that the LGC express a large gene family encoding related, yet distinct, MIP involved in the control of a wide range of functions.
MATERIALS AND METHODS
AnimalsL . stagnalis were brcd under standard conditions [7]. They were kept in tanks supplied with running tap water at 20°C and a 12-h/12-h lightldark cycle, and fed lettuce ad libitum. All experiments were performed with adult animals (26 -32 mm shell height).