A novel concept "D-A-π -A" organic sensitizer instead of traditional D-π -A ones is proposed. Remarkably, the incorporated low bandgap, strong electronwithdrawing unit of benzothiadiazole shows several favorable characteristics in the areas of light-harvesting and effi ciency: i) optimized energy levels, resulting in a large responsive range of wavelengths into NIR region; ii) a very small blue-shift in the absorption peak on thin TiO 2 fi lms with respect to that in solution; iii) an improvement in the electron distribution of the donor unit to distinctly increase the photo-stability of synthetic intermediates and fi nal sensitizers. The stability and spectral response of indoline dye-based DSSCs are improved by the strong electron-withdrawing benzothiadizole unit in the conjugation bridge. The incident-photon-conversion effi ciency of WS-2 reaches nearly 850 nm with a power conversion effi ciency as high as 8.7% in liquid electrolyte and 6.6% in ionic-liquid electrolyte.

Identification of protective T cell responses against SARS-CoV-2 requires distinguishing people infected with SARS-CoV-2 from those with cross-reactive immunity to other coronaviruses. Here we show a range of T cell assays that differentially capture immune function to characterise SARS-CoV-2 responses. Strong ex vivo ELISpot and proliferation responses to multiple antigens (including M, NP and ORF3) are found in 168 PCR-confirmed SARS-CoV-2 infected volunteers, but are rare in 119 uninfected volunteers. Highly exposed seronegative healthcare workers with recent COVID-19-compatible illness show T cell response patterns characteristic of infection. By contrast, >90% of convalescent or unexposed people show proliferation and cellular lactate responses to spike subunits S1/S2, indicating pre-existing cross-reactive T cell populations. The detection of T cell responses to SARS-CoV-2 is therefore critically dependent on assay and antigen selection. Memory responses to specific non-spike proteins provide a method to distinguish recent infection from pre-existing immunity in exposed populations.

Most of the >50,000 different pharmacologically active peptides in Conus venoms belong to a small number of gene superfamilies. In this work, the M-conotoxin superfamily is defined using both biochemical and molecular criteria. Novel excitatory peptides purified from the venoms of the molluscivorous species Conus textile and Conus marmoreus all have a characteristic pattern of Cys residues previously found in the mu-, kappaM-, and psi-conotoxins (CC-C-C-CC). The new peptides are smaller (12-19 amino acids) than the mu-, kappaM-, and psi-conotoxins (22-24 amino acids). One peptide, mr3a, was chemically synthesized in a biologically active form. Analysis of the disulfide bridges of a natural peptide tx3c from C. textile and synthetic peptide mr3a from C. marmoreus showed a novel pattern of disulfide connectivity, different from that previously established for the mu- and psi-conotoxins. Thus, these peptides belong to a new group of structurally and pharmacologically distinct conotoxins that are particularly prominent in the venoms of mollusc-hunting Conus species. Analysis of cDNA clones encoding the novel peptides as well as those encoding mu-, kappaM-, and psi-conotoxins revealed highly conserved amino acid residues in the precursor sequences; this conservation in both amino acid sequence and in the Cys pattern defines a gene superfamily, designated the M-conotoxin superfamily. The peptides characterized can be provisionally assigned to four distinct groups within the M-superfamily based on sequence similarity within and divergence between each group. A notable feature of the superfamily is that two distinct structural frameworks have been generated by changing the disulfide connectivity on an otherwise conserved Cys pattern.

The extent to which immune responses to natural infection with severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and immunization with vaccines protect against variants of concern (VOC) is of increasing importance. Accordingly, here we analyse antibodies and T cells of a recently vaccinated, UK cohort, alongside those recovering from natural infection in early 2020. We show that neutralization of the VOC compared to a reference isolate of the original circulating lineage, B, is reduced: more profoundly against B.1.351 than for B.1.1.7, and in responses to infection or a single dose of vaccine than to a second dose of vaccine. Importantly, high magnitude T cell responses are generated after two vaccine doses, with the majority of the T cell response directed against epitopes that are conserved between the prototype isolate B and the VOC. Vaccination is required to generate high potency immune responses to protect against these and other emergent variants.

Two organic D-A-π-A sensitizers LS-2 and WS-5 containing N-octyl substituted phthalimide and benzotriazole as auxiliary electron withdrawing units with similar dimension and structure architecture were systematically studied, focusing on photophysical and electrochemical as well as photovoltaic properties in nanocrystalline TiO(2)-based dye-sensitized solar cells (DSSCs). Interestingly, with similar five-member benzo-heterocycles, the two auxiliary acceptors of phthalimide and benzotriazole play exactly different roles in absorption and intramolecular charge transfer: (i) in contrast with WS-5 delocalized throughout the entire chromophore, the HOMO orbital of LS-2 is mainly located at the donor part due to the twist conformation with the existence of two carbonyl groups in phthalimide; (ii) the dihedral angles of "D-A" plane and "A-π" plane in LS-2 further suggest that the incorporation of phthalimide moiety results in curvature of electron delocalization over the whole molecule, in agreement with its blue-shifted, relatively narrow absorption spectra and low photocurrent density; (iii) in contrast with the beneficial charge transfer of benzotriazole in WS-5, the phthalimide unit in LS-2 plays an oppositely negative contribution to the charge transfer, that is, blocking intramolecular electron transfer (ICT) from donor to acceptor to some extent; and (iv) in electrochemical impedance spectroscopy, the incorporated benzotriazole unit enhances electron lifetime by 18.6-fold, the phthalimide only increases electron lifetime by 5.0-fold. Without coadsorption of chenodeoxylic acid (CDCA), the DSSCs based on WS-5 exhibited a promising maximum conversion efficiency (η) of 8.38% with significant enhancement in all photovoltaic parameters (J(SC) = 15.79 mA cm(-2), V(OC) = 791 mV, ff = 0.67). In contrast, with the very similar D-A-π-A feature changing the additional acceptor from benzotriazole to phthalimide unit, the photovoltaic efficiency based on LS-2 was only 5.11%, decreased by 39%, with less efficient photovoltaic parameters (J(SC) = 10.06 mA cm(-2), V(OC) = 748 mV, ff = 0.68). Therefore, our results demonstrate that it is essential to choose proper subsidiary withdrawing unit in D-A-π-A sensitizer configuration for DSSCs.

Conus peptides, including omega-conotoxins and alpha-conotoxins (targeting calcium channels and nicotinic acetylcholine receptors, respectively) have been useful ligands in neuroscience. In this report, we describe a new family of sodium channel ligands, the mu-O-conotoxins. The two peptides characterized, mu-O-conotoxins MrVIA and MrVIB from Conus marmoreus potently block the sodium conductance in Aplysia neurons. This is in marked contrast to standard sodium channel blockers that are relatively ineffective in this system. The sequences of the peptides are as follows. mu-O-conotoxin MrVIA: ACRKKWEYCIVPIIGFIYCCPGLICGPFVCV mu-O-conotoxin MrVIB: ACSKKWEYCIVPILGFVYCCPGLICGPFVCV mu-O-conotoxin MrVIA was chemically synthesized and proved indistinguishable from the natural product. Surprisingly, the mu-O-conotoxins show no sequence similarity to the mu-O-conotoxins. However, ananalysis of cDNA clones encoding the mu-O-conotoxin MrVIB demonstrated striking sequence similarity to omega- and delta-conotoxin precursors. Together, the omega-, delta-, and mu-O-conotoxins define the O-superfamily of Conus peptides. The probable biological role and evolutionary affinities of these peptides are discussed.

No abstract

For a sensitizer with a strong π‐conjugation system, a coadsorbent is needed to hinder dye aggregation. However, coadsorption always brings a decrease in dye coverage on the TiO2 surface. Organic ‘‘D–A–π–A’’ dyes, WS‐6 and WS‐11, are designed and synthesized based on the known WS‐2 material for coadsorbent‐free, dye‐sensitized solar cells (DSSCs). Compared with the traditional D–π–A structure, these D–A–π–A indoline dyes, with the additional incorporated acceptor unit of benzothiadiazole in the π‐conjugation, exhibit a broad photoresponse, high redox stability, and convenient energy‐level tuning. The attached n‐hexyl chains in both dyes are effective to suppress charge recombination, resulting in a decreased dark current and enhanced open‐circuit voltage. Electrochemical impedance spectroscopy studies indicate that both the resistance for charge recombination and the electron lifetime are increased after the introduction of alkyl chains to the dye molecules. Without deoxycholic acid coadsorption, the power‐conversion efficiency of WS‐6 (7.76%) on a 16 μm‐thick TiO2 film device is 45% higher than that of WS‐2 (5.31%) under the same conditions. The additional n‐hexylthiophene in WS‐11 extends the photoresponse to a panchromatic spectrum but causes a low incident photon‐to‐current conversion efficiency.