The complete nucleotide sequence of hydrangea ringspot virus

Abstract

The complete nucleotide sequence of the genome of the potexvirus, hydrangea ringspot virus, has been determined. The sequence is 6,185 nt in length, excluding the poly (A) tail, and contains six ORFs coding for proteins of 156, 26, 12, 8, 24, and 16 kDa, respectively. ORF 6 is contained within ORF 5 and in this respect the virus is similar to the potexviruses CsCMV, NMV, and SMYEV. Phylogenetic analysis of the putative products of the ORFs and signature motifs contained within these products shows the virus to be most closely related to CsCMV. A similar analysis of data for the coat proteins of potexviruses did not support the previously reported serological relationships between HdRSV and other potexviruses. This is the first complete sequence published for the genome of a potexvirus infecting a dicotyledonous, temperate, deciduous woody species.

The Sequence of the Genome of an Isolate of Hydrangea Ringspot Virus from the Czech Republic

“…2005), with RdRp motifs IV to VI revealing only two different amino acids (Ala → Gly and Gly → Glu; indicated in underscored bold type): [DQSQD G AMLQFEILKAKHFNIP E EIIQGYLDIKLNAKIFLGVLGIMRLTGEGPTFDANTECNIAYTHTRFDIPPGTAQLYAG‐ DDSAI]. Hughes et al. (2005) described a genetic signature that includes methyltransferase, helicase, polymerase and coat proteins, and this was also evident in our phylogenetic tree (Fig.…”

“…2005). The HydCZ isolate had the additional ORF6 within ORF5, which was also found in isolate PD109 and other potexviruses including Cassava common mosaic virus (CsCMV), Narcissus mosaic virus (NMV) and Strawberry mild yellow edge virus (SMYEV) (Hughes et al. 2005).…”

“…The complete genome of the HdRSV Czech isolate (HydCZ) was composed of 6185 nucleotides, excluding the 3′ terminal poly(A) tail. The genome consisted of six ORFs, similar to the HdRSV isolate PD109 from the Netherlands (Hughes et al. 2005).…”

“…The monopartite genome sequence of HdRSV is 6185 nucleotides in length, excluding the poly (A) tail, and contains six open reading frames (ORFs), respectively, encoding a replicase protein (156 kDa), the triple gene block protein 1 TGB1 (26 kDa), TGB2 (12 kDa), TGB3 (8 kDa), a coat protein (24 kDa) and a virus‐coded protein (16 kDa) (Batten et al. 2003; Hughes et al. 2005).…”

“…Hydrangea ringspot virus (HdRSV) is a positive-sense, single-stranded RNA virus (genus Potexvirus, family Flexiviridae; Adams et al 2005). The monopartite genome sequence of HdRSV is 6185 nucleotides in length, excluding the poly (A) tail, and contains six open reading frames (ORFs), respectively, encoding a replicase protein (156 kDa), the triple gene block protein 1 TGB1 (26 kDa), TGB2 (12 kDa), TGB3 (8 kDa), a coat protein (24 kDa) and a virus-coded protein (16 kDa) (Batten et al 2003;Hughes et al 2005). The virus is distributed worldwide due to the extensive trade of non-certified Hydrangea spp.…”