Primary Structure of 6.5k-Arginine/Glutamate-rich Polypeptide from the Seeds of Sponge Gourd (<i>Luffa cylindrica</i>)

Kimura, Makoto; Sakai, Ritsu; Yamasaki, Nobuyuki; Funatsu, Gunki

doi:10.1271/bbb.61.984

Cited by 12 publications

(9 citation statements)

References 9 publications

(10 reference statements)

Supporting

Mentioning

Contrasting

Order By: Relevance

“…The Luffin P1 gene (GenBank AF537345) encodes a short 43‐aa peptide [10, 11] (GSPRTEYEACRVRCQVAEHGVERQRRCQQVCEKRLREREGRRE) that is similar to the 6.5 kD arginine/glutamate‐rich polypeptide isolated from the seeds of sponge gourd ( L. cylindrica ) [8]. Luffin P1 (5.2 kD) is the smallest peptide so far reported that possesses rRNA N ‐glycosidase activity and strongly inhibits protein translation in cell‐free system [10, 11].…”

Section: Resultsmentioning

confidence: 99%

“…In 1994, Gao et al reported the discovery of a novel small RIP, Luffin‐S, from the seeds of the plant Luffa cylindrica [6]. Since then, quite a number of small RIPs (<10 kD) have been discovered from various plants [7–9]. The smallest member of this new family, Luffin P1, has a molecular weigh of 5226.8 Da, yet possessing a highly potent inhibitory activity on protein synthesis in the cell‐free rabbit reticulocyte lysate with IC50 of 0.88 nM [10, 11].…”

Section: Introductionmentioning

confidence: 99%

“…In 1994, Gao et al reported the discovery of a novel small RIP, Luffin-S, from the seeds of the plant Luffa cylindrica [6]. Since then, quite a number of small RIPs (Ͻ10 kD) have been discovered from various plants [7][8][9]. The smallest member of this new family, Luffin P1, has a molecular weigh of 5226.…”

Section: Introductionmentioning

confidence: 99%

“…The smallest member of this new family, Luffin P1, has a molecular weigh of 5226. 8 Da, yet possessing a highly potent inhibitory activity on protein synthesis in the cell-free rabbit reticulocyte lysate with IC50 of 0.88 nM [10,11]. From biochemistry point of view, it is intriguing that such a 43-aa peptide could form into structures required for rRNA N-glycosidase activity.…”

Section: Introductionmentioning

confidence: 99%

See 3 more Smart Citations

A novel recombinant immunotoxin with the smallest ribosome‐inactivating protein Luffin P1: T‐cell cytotoxicity and prolongation of allograft survival

Wang

Gan

Gao

et al. 2010

J Cellular Molecular Medi

View full text Add to dashboard Cite

In the creation of stable tolerance to MHC-incompatible allografts, reducing the large mass of donor-reactive cells via apoptosis is often required. Apoptosis induction by immunotoxins targeting surface molecules specifically presented on donor-reactive cytopathic T effector (Teff) cells is a promising strategy. Traditionally, the toxin moieties are bacterial exotoxins or plant-derived ribosome-inactivating proteins (RIPs) with large molecular size and strong immunogenicity, hence causing the problems of tissue penetration, host immune reaction and quick clearance. We have identified a novel class of small molecule RIPs (<10 kD) from the seeds of the plant Luffa cylindrica. The smallest member of this family, Luffin P1, has a molecular weight of 5226.8 Da, yet possessing a highly potent inhibitory activity on cell-free protein synthesis with IC50 of 0.88 nM. We now report a recombinant hIL-2-Luffin P1 immunotoxin, which strongly inhibited T-cell proliferation in mixed lymphocyte reaction and ConA response with IC50 of 1.8–10 nM. In vivo, hIL-2-Luffin P1 significantly prolonged the survival of major MHC-mismatched skin and kidney allografts in animal models. Thus, we demonstrate for the first time the efficacy of the smallest immunotoxin that could be further combined with other pharmacological and immunological reagents for synergistic control of pathogenic lymphocytes in immune-mediated diseases.

show abstract

Section: Resultsmentioning

confidence: 99%

Section: Introductionmentioning

confidence: 99%

Section: Introductionmentioning

confidence: 99%

Section: Introductionmentioning

confidence: 99%

See 2 more Smart Citations

A novel recombinant immunotoxin with the smallest ribosome‐inactivating protein Luffin P1: T‐cell cytotoxicity and prolongation of allograft survival

Wang

Gan

Gao

et al. 2010

J Cellular Molecular Medi

View full text Add to dashboard Cite

show abstract

“…In Hong Kong, at least two varieties are available: one with plump dark‐green fruits and another with slender, light‐green fruits. Charantin possesses an abundance of glutamine, glutamic acid and arginine residues in its N ‐terminal sequence and may thus be related to the AGRPs from Luffa cylindrica seeds (11,12).…”

Section: Discussionmentioning

confidence: 99%

Purification and characterization of charantin, a napin‐like ribosome‐inactivating peptide from bitter gourd (Momordica charantia) seeds

Parkash

Tso

2002

The Journal of Peptide Research

View full text Add to dashboard Cite

A peptide designated charantin, with a molecular mass of 9.7 kDa, was isolated from bitter gourd seeds. The procedure comprised affinity chromatography on Affi-gel blue gel, ion-exchange chromatography on Mono S and gel filtration on Superdex 75. The N-terminal sequence of charantin exhibited marked similarity to that of the 7.8-kDa napin-like peptide previously isolated from bitter gourd seeds. Charantin inhibited cell-free translation in a rabbit reticulocyte lysate system with an IC50 of 400 nm, a potency lower than that of the previously reported small ribosome-inactivating protein gamma-momorcharin (IC50 = 55 nm) which also exhibited an abundance of arginine and glutamate/glutamine residues. Charantin reacted positively in the N-glycosidase assay, yielding a band similar to that formed by the small ribosome-inactivating proteins gamma-momorcharin and luffin S.

show abstract

Proteinase Inhibitors from Buckwheat (Fagopyrum esculentum Moench) Seeds

Dunaevsky

Khadeeva

Egorov

et al. 2011

Nuts and Seeds in Health and Disease Prevention

View full text Add to dashboard Cite

Primary Structure of 6.5k-Arginine/Glutamate-rich Polypeptide from the Seeds of Sponge Gourd (Luffa cylindrica)

Cited by 12 publications

References 9 publications

A novel recombinant immunotoxin with the smallest ribosome‐inactivating protein Luffin P1: T‐cell cytotoxicity and prolongation of allograft survival

A novel recombinant immunotoxin with the smallest ribosome‐inactivating protein Luffin P1: T‐cell cytotoxicity and prolongation of allograft survival

Purification and characterization of charantin, a napin‐like ribosome‐inactivating peptide from bitter gourd (Momordica charantia) seeds

Proteinase Inhibitors from Buckwheat (Fagopyrum esculentum Moench) Seeds

Contact Info

Product

Resources

About