Overexpression of potassium channel ether à go-go in human osteosarcoma

Abstract

Human ether à go-go (hEAG) potassium channels are primarily expressed in brain but also frequently overexpressed in solid tumors, which could indicate their potential value for cancer diagnosis and therapy. hEAG1, one member of the hEAG subfamily, has been shown to play a role in neoplastic process. Here we report the expression of hEAG1 in human osteosarcoma detected by a new polyclonal antibody. The full-length hEAG1 cDNA was cloned from human osteosarcoma cell line MG63 by RT-PCR and expressed in Escherichia coli as His tagged protein. The 6His-hEAG1F protein was purified by nickel agarose and used as the antigen to immunize rabbits following standard protocols. The obtained antiserum could detect hEAG1 exogenously expressed in HEK 293 cells. Furthermore, the polyclonal antibody was used to evaluate hEAG1 expression in 42 human osteosarcoma specimens and 19 osteochondromas specimens by immunohistochemistry. hEAG1 was expressed in 71.4% (30/42) osteosarcoma, and 15.8% (3/19) osteochondromas. Moreover, statistical analysis revealed that hEAG1 expression was not dependent on age, sex, site, histology, grade and type in the osteosarcoma specimens. Our data provide evidence that hEAG1 is overexpressed in human osteosarcoma and the hEAG1 polyclonal antibody offers a good tool for further characterization of the oncogenic function of hEAG1 in osteosarcoma.

Circular RNA hsa-circ-0016347 promotes proliferation, invasion and metastasis of osteosarcoma cells

“…Since miRNAs have been largely reported to regulate gene expression, investigating the function of circRNAs will enable us to better understand the mechanisms underlying the occurrence and development of the associated diseases. Based on the findings in previous studies that potassium voltage-gated channel subfamily H member 1 (KCNH1) was overexpressed in osteosarcoma and promoted the proliferation and invasion of osteosarcoma [11–13] and on our profile of the miRanda, PITA, RNAhybrid databases to explore the corresponding circRNAs of KCNH1, we speculated that hsa-circ-0016347 may be a potential regulator of osteosarcoma progression.…”

MicroRNA-34a Inhibits Human Osteosarcoma Proliferation by Downregulating Ether à go-go 1 Expression

“…In particular, Eag1 (Kv10.1, KCNH1) channel attracts much interest due to its close relation to tumor growth, progression and metastasis. Eag1 is a central nervous system (CNS)-localized channel that is overexpressed in several tumor cell lines and more than 75% of primary solid tumors 22-24. The suppression of Eag1 expression caused a significant reduction of cancer cell proliferation 25-27.…”

Natural Anticancer Peptides from Marine Animal Species: Evidence from In Vitro Cell Model Systems

“…It is highly competitive for space and characterized by the ability to emit poison using structures of "aggression" called acrorhagi [34]. The voltage-gated potassium channel human ether-à-go-go 1 (hEag1, KV10.1), undetectable in normal tissues except for central nervous tissue, is widely overexpressed in different human tumor cyto-and histotypes, thereby being considered as a potential target for anticancer treatment [35,36]. In search of novel KV10.1 inhibitors, Moreels et al [37] reported the isolation of the peptide APETx4 (GTTCYCGKYIGIYWFGKYSCPTNRGYTGSCPYFLGICCYPVD) from A. elegantissima, which is able to bind to closed KV10.1 channels through its YFL hydrophobic patch and the charged residues present on one side and reduce their activation rate.…”