Molecular characterization, expression analysis, and bactericidal activity of the derivative peptides of TFPI-1 and TFPI-2 in half-smooth tongue sole, Cynoglossus semilaevis

Zhao, Xin-peng; He, Shuwen; Yue, Bin; Wang, Guanghua; Zhang, Min

doi:10.1016/j.fsi.2016.10.003

Cited by 10 publications

(2 citation statements)

References 44 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…Tissue factor pathway inhibitor (TFPI) encodes TFPI, a Kunitz-type serine protease inhibitor. [13] The TFPI downregulates the tissue factor (TF)-dependent pathway by inhibiting both tissue factor-activated factor VII and activation of factor X, thereby limiting clot growth and preventing prothrombin to thrombin conversion. [14–17] Low TFPI plasma level is associated with increases risk of venous thrombosis.…”

Section: Introductionmentioning

confidence: 99%

Association of TFPI polymorphisms rs8176592, rs10931292, and rs10153820 with venous thrombosis

et al. 2019

View full text Add to dashboard Cite

Background: Tissue factor pathway inhibitor ( TFPI ) polymorphisms are known to be involved in venous thrombosis; however, any correlation between the TFPI polymorphisms rs8176592, rs10931292, and rs10153820 and venous thrombosis remains controversial. This meta-analysis aimed to elucidate the relationship between these TFPI polymorphisms and the susceptibility to venous thrombosis. Methods: A literature search for relevant studies was conducted in PubMed, Embase, Cochrane Library, China National Knowledge Infrastructure (CNKI), and Wanfang Med Online databases. Odds ratios (ORs) and their corresponding 95% confidence intervals (95% CIs) were calculated using fixed-effect/random-effect models by the STATA 12.0 software. Sources of heterogeneity were analyzed by subgroup analysis. Results: Eleven case-control studies involving 3740 subjects (1362 venous thrombosis patients and 2378 healthy controls) were included. The TFPI rs8176592 polymorphism was associated with increased risk of venous thrombosis in the whole population, while no significant association was found between rs10931292/rs10153820 and venous thrombosis. In subgroup analysis based on ethnicity, an increased risk was observed with rs8176592 polymorphism in Asians (Recessive model, OR = 1.48, 95% CI = 1.06–2.07, P = .023). An increased risk associated with rs10931292 was identified in non-Asians (Recessive model, OR = 1.42, 95% CI = 1.03–1.97, P = .033). No significant association was found in either Asians or non-Asians with the rs10153820 polymorphism. In subgroup analysis based on source of controls, increased risks were identified in the hospital-based group with rs8176592 polymorphism and in the population-based group with rs10931292 polymorphism, whereas decreased risk was identified in the hospital-based group with the rs10931292 and rs10153820 polymorphisms. Conclusion: Meta-analysis suggested that different TFPI polymorphisms may have different associations with venous thrombosis. TFPI rs8176592 polymorphism may increase the risk of venous thrombosis, especially in Asians and hospital-based patients. The TFPI rs10931292 polymorphism may increase the venous thrombosis risk for both non-Asians and population-based patients. Moreover, rs10931292 and rs10153820 polymorphisms of TFPI may decrease the risk of venous thrombosis for hospital-based patients.

show abstract

Section: Introductionmentioning

confidence: 99%

Association of TFPI polymorphisms rs8176592, rs10931292, and rs10153820 with venous thrombosis

et al. 2019

View full text Add to dashboard Cite

show abstract

“…Two members of the tissue factor pathway inhibitor (TFPI) family [10,11], TFPI-1 and its analog TFPI-2, are Kunitz-serine protease inhibitors that reversibly regulate blood coagulation [12][13][14]. Similar to TFPI-1, TFPI-2 has three Kunitz-type domains (KDs) distributed at the negatively charged N-terminus and the positively charged C-terminus [15]; these three kunitz domains have different functions: the first can bind and inhibit the function of the TF/VI complex, the second can bind and inhibit the function of the Xa factor and the last domain is closely related to the metabolism of TFPI-2 in the body [16,17].…”

Section: Introductionmentioning

confidence: 99%

Antimicrobial and Immunoregulatory Activities of TS40, a Derived Peptide of a TFPI-2 Homologue from Black Rockfish (Sebastes schlegelii)

Wang

Ding

et al. 2022

Marine Drugs

Self Cite

View full text Add to dashboard Cite

Tissue factor pathway inhibitor-2 (TFPI-2) is a Kunitz-type serine protease inhibitor. Previous reports have shown that TFPI-2 plays an important role in innate immunity, and the C-terminal region of TFPI-2 proved to be active against a broad-spectrum of microorganisms. In this study, the TFPI-2 homologue (SsTFPI-2) of black rockfish (Sebastods schegelii) was analyzed and characterized, and the biological functions of its C-terminal derived peptide TS40 (FVSRQSCMDVCAKGAKQHTSRGNVRRARRNRKNRITYLQA, corresponding to the amino acid sequence of 187-226) was investigated. The qRT-PCR (quantitative real-time reverse transcription-PCR) analysis showed that the expression of SsTFPI-2 was higher in the spleen and liver. The expression of SsTFPI-2 increased significantly under the stimulation of Listonella anguillarum. TS40 had a strong bactericidal effect on L. anguillarum and Staphylococcus aureus. Further studies found that TS40 can destroy the cell structure and enter the cytoplasm to interact with nucleic acids to exert its antibacterial activity. The in vivo study showed that TS40 treatment could significantly reduce the transmission of L. anguillarum and the viral evasion in fish. Finally, TS40 enhanced the respiratory burst ability, reactive oxygen species production and the expression of immune-related genes in macrophages, as well as promoted the proliferation of peripheral blood leukocytes. These results provide new insights into the role of teleost TFPI-2.

show abstract

A teleost bactericidal permeability-increasing protein-derived peptide that possesses a broad antibacterial spectrum and inhibits bacterial infection as well as human colon cancer cells growth

Liu

et al. 2021

Developmental & Comparative Immunology

View full text Add to dashboard Cite

Molecular characterization, expression analysis, and bactericidal activity of the derivative peptides of TFPI-1 and TFPI-2 in half-smooth tongue sole, Cynoglossus semilaevis

Cited by 10 publications

References 44 publications

Association of TFPI polymorphisms rs8176592, rs10931292, and rs10153820 with venous thrombosis

Association of TFPI polymorphisms rs8176592, rs10931292, and rs10153820 with venous thrombosis

Antimicrobial and Immunoregulatory Activities of TS40, a Derived Peptide of a TFPI-2 Homologue from Black Rockfish (Sebastes schlegelii)

A teleost bactericidal permeability-increasing protein-derived peptide that possesses a broad antibacterial spectrum and inhibits bacterial infection as well as human colon cancer cells growth

Contact Info

Product

Resources

About