Genome Sequence of Enterococcus faecium Strain ICIS 96 Demonstrating Intermicrobial Antagonism Associated with Bacteriocin Production

Пашкова, Т. М.; Vasilchenko, Alexey S.; Khlopko, Yuriy A.; Kochkina, E.E.; Карташова, О. Л.; Sycheva, M. V.

doi:10.1128/genomea.00126-18

Cited by 3 publications

(2 citation statements)

References 6 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…Even though features of the various enterocins have been determined, genome information and details of the biosynthesis mechanisms have been unknown. Also, the genome information of enterocin-producing strains, including E. faecium ICIS 96 (Pashkova et al, 2018), E . faecium CRL1879 (Bonacina et al, 2017), and E .…”

Section: Discussionmentioning

confidence: 99%

Genetic and Biochemical Evidence That Enterococcus faecalis Gr17 Produces a Novel and Sec-Dependent Bacteriocin, Enterocin Gr17

Liu

Wang

et al. 2019

Front. Microbiol.

View full text Add to dashboard Cite

Bacteriocins are ribosomally synthesized antibacterial peptides or proteins from microorganisms. We report a novel bacteriocin producing strain, Enterococcus faecalis Gr17, that was isolated from the Chinese traditional low-salt fermented whole fish product Suan yu. E. faecalis Gr17 displayed potent antibacterial activity against foodborne pathogenic and spoilage bacteria. The complete genome of E. faecalis Gr17 contained one circular chromosome and plasmid. The gene cluster of a novel bacteriocin designated enterocin Gr17 was identified. The enterocin Gr17 structural gene encodes a precursor of the bacteriocin. Two other transporter genes and an immunity gene within two divergent operons were identified as being associated with enterocin Gr17 secretion and protection. The novel enterocin Gr17 was purified by ammonium sulfate precipitation, cation exchange, gel filtration, and reverse-phase high-performance liquid chromatography. The molecular weight of enterocin Gr17 was 4,531.01 Da as determined by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry and its mature amino acid sequence of enterocin Gr17 was RSYGNGVYCNNSKCWVNWGEAKENIIGIVISGWATGLAGMGR. Sequence alignment revealed that enterocin Gr17 is a class IIa bacteriocin with similarities to enterocin P. The merits of bactericidal activity, sensitivity to enzymes, and pronounced stability to chemicals, temperature (60°C, 30 min and 121°C, 15 min), and pH (2–10) indicated practicality and safety of enterocin Gr17 in the food industry. The complete genome information of E. faecalis Gr17 will improve the understanding of the biosynthetic mechanism of enterocin Gr17, which has potential value as a food biopreservative.

show abstract

Section: Discussionmentioning

confidence: 99%

Genetic and Biochemical Evidence That Enterococcus faecalis Gr17 Produces a Novel and Sec-Dependent Bacteriocin, Enterocin Gr17

Liu

Wang

et al. 2019

Front. Microbiol.

View full text Add to dashboard Cite

show abstract

“…As a result of a wide search for biotechnologically valuable crops among the representatives of this genus, we managed to isolate the culture Enterococcus faecium ICIS 96, a detailed description of which is presented in our work [12]. The strain was deposited in the Departmental collection of useful microorganisms for agricultural purposes of the DAS RAS as a promising one for inclusion in the composition of a probiotic feed additive.…”

Section: Introductionmentioning

confidence: 99%

The change in the energy metabolism of broiler chickens under the influence of Enterococcus faecium ICIS 96

et al. 2020

View full text Add to dashboard Cite

The intensive development of domestic poultry farming determines the urgent need to achieve the environmental safety of the industry's products, which excludes the introduction of feed antibiotics into the poultry diet. In addition, the existing instability in the market for domestic biological products, whose share is currently no more than 40% and continues to decline steadily, dictates the need to search for approaches to import substitution. An example of a current trend in poultry farming is the use of domestic veterinary drugs of natural origin, which include probiotic feed additives containing cultures of live lactic acid microorganisms, typical representatives of which are enterococci. A wide search for bio-technologically valuable microorganisms among representatives of the genus Enterococcus allowed us to isolate and characterize the Enterococcus faecium ICIS 96 strain, which is promising for creating a probiotic feed additive. It is known from the literature that lactic acid microorganisms are able to regulate the metabolism of poultry. It is appropriate to assume that the culture of E. faecium ICIS 96, when introduced into the diet of poultry, can have a beneficial effect on energy metabolism. Clarification of this assumption determined the purpose of our work.

show abstract

Probiotic Feed Additive Based on Microorganisms of the Enterococcus Genus in the Diet of Quails

Gerasimenko,

Ezhova,

Goncharov

et al. 2023

Russ. Agricult. Sci.

View full text Add to dashboard Cite

Genome Sequence of Enterococcus faecium Strain ICIS 96 Demonstrating Intermicrobial Antagonism Associated with Bacteriocin Production

Cited by 3 publications

References 6 publications

Genetic and Biochemical Evidence That Enterococcus faecalis Gr17 Produces a Novel and Sec-Dependent Bacteriocin, Enterocin Gr17

Genetic and Biochemical Evidence That Enterococcus faecalis Gr17 Produces a Novel and Sec-Dependent Bacteriocin, Enterocin Gr17

The change in the energy metabolism of broiler chickens under the influence of Enterococcus faecium ICIS 96

Probiotic Feed Additive Based on Microorganisms of the Enterococcus Genus in the Diet of Quails

Contact Info

Product

Resources

About