Four different synthetic peptides of proteolipid protein induce a distinct antibody response in MP4-induced experimental autoimmune encephalomyelitis

Myelin-derived and putative molecular mimic peptides share structural properties in aqueous and membrane-like environments

“…Peptides or proteins were added at the start of the experiment, and the MOBP37-60 EIVDRKYSICKSGCFYQKKEEDWI alpha/disordered [8] hMOG35-55 MEVGWYRPPFSRVVHLYRNGK beta/disordered [6] mMOG35-55 MEVGWYRSPFSRVVHLYRNGK beta/disordered [6] HSV-mimic FRQLVHFVRDFAQLL alpha [19] EB-mimic TGGVYHFVKKHVHES alpha [19] IA-mimic YRNLVWFIKKNTRYP beta/disordered [19] PA-mimic DRLLMLFAKDVVSRN alpha [19] P2gbs ENFDDYMKALGV alpha/disordered [78] PLP139-151 VSLGKWLGHPDKF alpha/disordered [4] PLPextra2 FNTWTTCQSIAFPSKTSASIGSLCADARMYG alpha/disordered [5,60] PLPintra1 AEGFYTTGAVEQIFGDYKTTICGKGLSATVTGGQKGRG mixed [60,100] PLPintra2 SRGQHQAHSLERVCHCLGKWLGHPDKFVGI alpha/disordered [4,60] The predicted structure corresponds to that obtained from PEP-FOLD. References for the possible disease linkage of each peptide are also given experiment was carried out essentially as described before [41].…”

“…The MOBP37-60 peptide has pronounced beta content, while MOBP15-36 is more helical epitopes (Fig. 6a) shown to induce antibody responses related to demyelination in EAE [60,61]. In the overlapping peptides PLP139-151 and PLPintra2, a region with strong propensity to fold into an amphipathic helix can be detected (Fig.…”