Corrigendum to: Contribution of histone N‐terminal tails to the structure and stability of nucleosomes

Abstract

Recently, Iwasaki et al. [1] noticed that the tlH4 (tail-less H4) protein used in their study contained an additional amino acid sequence, MVDLQAAANSLVIHM, at its N-terminal end. This sequence, which is derived from the cloning vector, was mistakenly inserted. Specifically, the tlH4 protein contains this additional sequence downstream of the N-terminal thrombin cleavage site and before the H4K16 residue, as shown below. GSH-MVDLQAAANSLVIHM-KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLE NVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGThe inserted sequence is not seen in the electron density maps (PDB: 3w99), but neither was the authentic Nterminal tail of histone H4 in the other three related structures (PDB: 3w96, 3w97, and 3w98) analyzed in this paper. Thus, the additional sequence did not influence the structural results, even though it may be questionable for the interpretation of the biological properties of the supposedly 'tail-less' histone H4. The authors apologize for any inconvenience this may have caused, and would like to have the opportunity to make this correction.

HEMNMA-3D: Cryo Electron Tomography Method Based on Normal Mode Analysis to Study Continuous Conformational Variability of Macromolecular Complexes

“…A density map obtained with classical subtomogram averaging (without taking into account conformational heterogeneity) was used as the reference density map for HEMNMA-3D ( Figure 10C ). The resolution of this reference density map is around 2 nm (as determined by Fourier Shell Correlation between the reference density map and the density map from the atomic nucleosome structure PDB:3w98 Iwasaki et al, 2013 shown in Figure 10B ). For more information on how this reference density map (global initial subtomogram average) was obtained, please see section 1 of the Supplementary Material (Nucleosome data preparation and acquisition).…”