Chromatographic and related electrophoretic methods in the separation of transition metal complexes or their ligands

Shepherd, Rex E.

doi:10.1016/s0010-8545(03)00125-5

Cited by 42 publications

(11 citation statements)

References 238 publications

Supporting

Mentioning

Contrasting

Order By: Relevance

“…It is known that the molecular recognition also plays a significant role during proteins separation on metal complexes immobilized on a chromatographic matrix (Shepherd 2003). As was mentioned above (Kruppa et al, 2006), the imidazole substrate is recognized by [ZnL] 2þ receptor.…”

Section: Introductionmentioning

confidence: 96%

Amino acids binding to Zn²⁺‐cyclen molecular receptor in aqueous solution

Vargová

Balentová

Walko

et al. 2011

J of Molecular Recognition

View full text Add to dashboard Cite

Potentiometric titrations and (1) H NMR spectroscopic studies of amino acids binding to the [ZnL](2+) -complex where L=cyclen in aqueous solution provide information concerning complexing species identity, their stability, and coordination mode declaration. The amino acids form stable ternary [ZnL(HL(n))](2+) and [ZnL(L(n))](+) complexes. The observations indicate bidentate coordination mode of the deprotonated amino acids, involving both the amine and the carboxylate functions to the [ZnL](2+) complex in pH region of about 7.5-9.5. The determined stability constants indicate that [ZnL](2+) complex is a very efficient receptor for simple amino acids such as glycine and alanine.

show abstract

Section: Introductionmentioning

confidence: 96%

Amino acids binding to Zn²⁺‐cyclen molecular receptor in aqueous solution

Vargová

Balentová

Walko

et al. 2011

J of Molecular Recognition

View full text Add to dashboard Cite

show abstract

“…(J E xploiting the advantages of electrospray (ES) coupled to trapping mass spectrometers (quadrupole ion trap or Fourier transform ion cyclotron resonance) to investigate the chemistry of aqueous metal ions offers a unique avenue for investigating these complex aqueous chemical systems in detail. This is accomplished by taking advantage of their MS n capability [1][2][3][4]. Understanding the aqueous chemistry of palladium(II) complexes is of considerable interest because of their interactions with biologically important molecules [5][6][7] and their use as model systems for Pt(II) complexes [7-9], four of which, cisplatin, carboplatin, oxaliplatin, and nedaplatin, are currently registered for clinical use [10,11].…”

mentioning

confidence: 99%

“…This is accomplished by taking advantage of their MS n capability [1][2][3][4]. Understanding the aqueous chemistry of palladium(II) complexes is of considerable interest because of their interactions with biologically important molecules [5][6][7] and their use as model systems for Pt(II) complexes [7][8][9], four of which, cisplatin, carboplatin, oxaliplatin, and nedaplatin, are currently registered for clinical use [10,11].…”

mentioning

confidence: 99%

“…They postulate that the dimers and trimers were attributable to the impact of concentration on the formation of noncovalent clusters. However, if these are noncovalently bound clusters, it would be reasonable to expect losses of the Pt(TPA) 3 Cl subunits rather than just the TPA ligand. They did not, however, observe the loss of Pt(TPA) 3 Cl from the CID of the dimers or trimers.…”

mentioning

confidence: 99%

See 1 more Smart Citation

Complexes of dibromo(ethylenediamine)-palladium(II) observed from aqueous solutions by electrospray mass spectrometry

Bach

Sepeda

Merrill

et al. 2005

J. Am. Soc. Mass Spectrom.

View full text Add to dashboard Cite

The dimeric complex of dibromo(ethylenediamine)palladium(II) observed in water was investigated using electrospray mass spectrometry. One microM aqueous solutions of Pd(en)Br2 yielded a variety of previously unreported species. The most abundant ion observed was attributable to the Pd(en)Br2.Pd(en)Br+ dimeric complex at m/z 568.7 (most abundant stable isotopes). The characteristics of the oligomeric complexes were examined using collision-induced dissociation (CID) up to MS6. The most common loss mechanism observed was loss of HBr leaving an unsaturated Pd(II) center. Fragmentation of the ethylenediamine ligand was also observed during CID experiments. Loss of Pd was only observed as the final step in the CID process when other loss mechanisms had been exhausted. A number of calculations were carried out at the B3-LYP/SBKJC[d] level of theory in an attempt to elucidate the structure of the [2M-Br]+ dimer.

show abstract

“…The behavior of HMBP in the copper-immobilized column was similar to that of other metal-binding proteins, including (4), and the tight binding of soft metal ions such as copper ion to proteins can be achieved by multiple interactions between several histidyl residues and metal ion (8,15,20,24). However, HMBP has only one histidine in its amino acid sequence (Fig.…”

mentioning

confidence: 82%

Cloning of a Heavy-Metal-Binding Protein Derived from Activated-Sludge Microorganisms

Sano

Myojo

Omura

2006

Appl Environ Microbiol

View full text Add to dashboard Cite

A gene of the heavy-metal-binding protein (HMBP) was newly isolated from a genetic DNA library of activated-sludge microorganisms. HMBP was produced by transformed Escherichia coli, and the copperbinding ability of HMBP was confirmed. HMBP derived from activated sludge could be available as heavy metal adsorbents in water and wastewater treatments.Water pollution with anthropogenic heavy metals has been reported throughout the world (9, 19). Although heavy metal removal in water and wastewater treatment processes is crucial to protect the water environment from heavy metal pollution, conventional physicochemical procedures for heavy metal removal have several disadvantages in processing a large volume of polluted water. Heavy metal removal technologies such as chemical precipitation and ion exchange have been in practical use, but a large amount of energy and troublesome treatments for chemical wastes are required to employ these conventional technologies in water and wastewater treatment. It is important to develop feasible and economical technologies for removing heavy metals from a large volume of polluted water.In light of the above, attention has been paid to heavy metal removal with environmental biotechnology using biological materials. Especially, biosorption has been extensively exploited, in which the affinity and specificity of heavy metal binding are utilized (5,7,12,26). In our previous study, the methodology for isolating heavy-metal-binding proteins (HMBPs) from metal-stimulated activated-sludge culture was constructed (2). These HMBPs were separated with twodimensional electrophoresis, and N-terminal sequences of HMBPs were successfully analyzed (17). Since these HMBPs were expected to be stable under conditions of water and wastewater treatments, it would be possible to utilize HMBPs as novel adsorbents for heavy metal removal if mass volumes of HMBPs could be obtained with a gene cloning technique.In this study, the HMBP gene (hmbp) coding the same amino acid sequence of HMBP in our previous study (17) (ASSGLSDDEIERMVREAEANAAEDKKFEELVQTRNQ ADXLVH) was newly isolated from a genomic DNA library of activated-sludge microorganisms. In order to obtain the gene of interest, the consensus-degenerate hybrid oligonucleotide primer method (13), touchdown PCR (6), and seminested PCR were employed. Four steps of PCRs were required to obtain possible HMBP genes (see Fig. S1 and Tables S1 and S2 in the supplemental material). As a result, the target gene was successfully amplified, which codes the same amino acid sequence with HMBP in our previous study (Fig. 1). Two acidic amino acids (aspartic acid and glutamic acid) occupied 24% of a deduced amino acid sequence of HMBP, and the rate of metal-coordinating amino acids (aspartic acid, glutamic acid, serine, methionine, and histidine) among the deduced sequence of HMBP reached 35%. The value of the isoelectric point (pI) estimated from its amino acid sequence was 4.2 (22). The sequence determination of the upstream region in the obtained clone (see Fig. S2 in...

show abstract

Chromatographic and related electrophoretic methods in the separation of transition metal complexes or their ligands

Cited by 42 publications

References 238 publications

Amino acids binding to Zn²⁺‐cyclen molecular receptor in aqueous solution

Amino acids binding to Zn²⁺‐cyclen molecular receptor in aqueous solution

Complexes of dibromo(ethylenediamine)-palladium(II) observed from aqueous solutions by electrospray mass spectrometry

Cloning of a Heavy-Metal-Binding Protein Derived from Activated-Sludge Microorganisms

Contact Info

Product

Resources

About

Chromatographic and related electrophoretic methods in the separation of transition metal complexes or their ligands

Cited by 42 publications

References 238 publications

Amino acids binding to Zn2+‐cyclen molecular receptor in aqueous solution

Amino acids binding to Zn2+‐cyclen molecular receptor in aqueous solution

Complexes of dibromo(ethylenediamine)-palladium(II) observed from aqueous solutions by electrospray mass spectrometry

Cloning of a Heavy-Metal-Binding Protein Derived from Activated-Sludge Microorganisms

Contact Info

Product

Resources

About

Amino acids binding to Zn²⁺‐cyclen molecular receptor in aqueous solution

Amino acids binding to Zn²⁺‐cyclen molecular receptor in aqueous solution